Structure of PDB 5t7o Chain A

Receptor sequence

>5t7oA (length=494) Species: 353153 (Trypanosoma cruzi strain CL Brener)

SLFKIRMPETVAEGTRLALRAFSLVVAVDEHGGIGNVPEDMKFFRDLTTK
LRGKNVKPSPAKRNAVVMGRKTWDSIPPKFRPLPGRLNVVLSSTLTTQHL
LDGLPNLHADSIVAVNGGLEQALRLLASPNYTPSIETVYCIGGGSVYAEA
LRPPCVHLLQAIYRTTIRAVFFRVPESGTEAAAGIEWQRETISEELTSAN
GNETKYYFEKLIPRNREEEQYLSLVDRIIREGNVKHDTGVGTLSIFGAQM
RFSLRNNRLPLLTTKRVFWRGVCEELLWFLRGETYAKKLSDKGVHIWDDN
GSRAFLDSRGLTEYEEMDLGPVYGFQWRHFGAAYTHHDANYDGQGVDQIK
AIVETLKTNPDDRRMLFTAWNPSALPRMALPPCHLLAQFYVSNGELSCML
YQRSCDMGLGVPFNIASYALLTILIAKATGLRPGELVHTLGDAHVYSNHV
EPCNEQLKRVPRAFPYLVFRREREFLEDYEEGDMEVIDYAPYPP

3D structure

• PDB: 5t7o Crystal structure of Trypanosoma cruzi Dihydrofolate Reductase-Thymidylate Synthase in complex with (6S)-5,6,7,8-TETRAHYDROFOLATE
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D48 E295 W317 Y343 C403 R423 D426
• Catalytic site (residue number reindexed from 1): D40 E275 W297 Y323 C383 R403 D406
• Enzyme Commision number: 1.5.1.3: dihydrofolate reductase.
  2.1.1.45: thymidylate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	A	A28 I35 G36 G77 R78 K79 T80 S83 L99 S100 S101 G130 G131 G156 S158 Y160	A27 I34 G35 G69 R70 K71 T72 S75 L91 S92 S93 G117 G118 G143 S145 Y147
BS02	THG	A	V26 V27 A28 D48 M49 F52 R53 P85 F88 L91 R94 Y160	V25 V26 A27 D40 M41 F44 R45 P77 F80 L83 R86 Y147
BS03	UMP	A	C403 Q422 R423 S424 D426 G430 N434 H464 Y466	C383 Q402 R403 S404 D406 G410 N414 H444 Y446

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004146 dihydrofolate reductase activity
• GO:0004799 thymidylate synthase activity
• GO:0008168 methyltransferase activity
• GO:0016491 oxidoreductase activity
• GO:0016741 transferase activity, transferring one-carbon groups

Biological Process

• GO:0006231 dTMP biosynthetic process
• GO:0006730 one-carbon metabolic process
• GO:0009165 nucleotide biosynthetic process
• GO:0032259 methylation
• GO:0046654 tetrahydrofolate biosynthetic process

Cellular Component

• GO:0005739 mitochondrion
• GO:0005829 cytosol

External links

• PDB: RCSB:5t7o, PDBe:5t7o, PDBj:5t7o
• PDBsum: 5t7o
• UniProt: Q4DLS1