Structure of PDB 5t4u Chain A |
>5t4uA (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] |
MQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFT MKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGA VLRQARRQAEKM |
|
PDB | 5t4u Design of a Biased Potent Small Molecule Inhibitor of the Bromodomain and PHD Finger-Containing (BRPF) Proteins Suitable for Cellular and in Vivo Studies. |
Chain | A |
Resolution | 1.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
12Q |
A |
V657 P658 N708 F714 |
V30 P31 N81 F87 |
MOAD: ic50=4800nM PDBbind-CN: -logKd/Ki=5.32,IC50=4800nM BindingDB: IC50=4800nM |
|
|