Structure of PDB 5t16 Chain A

Receptor sequence

>5t16A (length=276) Species: 559292 (Saccharomyces cerevisiae S288C)

YDPTKAGDIVKATKWPPKLPEIQDLAIRARVFIHKSTIKDKVYLSGSEMI
NAHNERLEFLGDSILNSVMTLIIYNKFPDYSEGQLSTLRMNLVSNEQIKQ
WSIMYNFHEKLKTNFDLKDENSNFQNGKLKLYADVFEAYIGGLMEDDPRN
NLPKIRKWLRKLAKPVIEEATRNQVALEKTDKLDMNAKRQLYSLIGYASL
RLHYVTVKKPTAVDPNSIVECRVGDGTVLGTGVGRNIKIAGIRAAENALR
DKKMLDFYAKQRAAIPRSESVLKDPS

3D structure

• PDB: 5t16 The Functional Cycle of Rnt1p: Five Consecutive Steps of Double-Stranded RNA Processing by a Eukaryotic RNase III.
• Chain: A
• Resolution: 2.783 Å

Enzymatic activity

• Enzyme Commision number: 3.1.26.3: ribonuclease III.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	G266 S269 T270 K371 R372 Q373 Y375 S376 G379 Y380 A381 N419 I420 K421 R445 R450 S453 V454 L455 K456	G83 S86 T87 K188 R189 Q190 Y192 S193 G196 Y197 A198 N236 I237 K238 R262 R267 S270 V271 L272 K273
BS02	rna	A	H217 K218 K222 F298 N306 F307 K311 K313	H34 K35 K39 F115 N123 F124 K128 K130

Gene Ontology

Molecular Function

• GO:0003725 double-stranded RNA binding
• GO:0004525 ribonuclease III activity

Biological Process

• GO:0006364 rRNA processing
• GO:0006396 RNA processing

External links

• PDB: RCSB:5t16, PDBe:5t16, PDBj:5t16
• PDBsum: 5t16
• PubMed: 28111020
• UniProt: Q02555|RNT1_YEAST Ribonuclease 3 (Gene Name=RNT1)