Structure of PDB 5szx Chain A

Receptor sequence
>5szxA (length=62) Species: 10376 (human gammaherpesvirus 4) [Search protein sequence]
LEIKRYKNRVASRKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPS
LDVDSIIPRTPD
3D structure
PDB5szx Methyl-dependent and spatial-specific DNA recognition by the orthologous transcription factors human AP-1 and Epstein-Barr virus Zta.
ChainA
Resolution2.251 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R179 N182 R183 S186 R187 R190 K194 R5 N8 R9 S12 R13 R16 K20 PDBbind-CN: Kd=0.017uM
BS02 dna A A185 S186 K188 S189 K192 A11 S12 K14 S15 K18 PDBbind-CN: Kd=0.017uM
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5szx, PDBe:5szx, PDBj:5szx
PDBsum5szx
PubMed28158710
UniProtP03206|BZLF1_EBVB9 Lytic switch protein BZLF1 (Gene Name=BZLF1)

[Back to BioLiP]