Structure of PDB 5sze Chain A

Receptor sequence

>5szeA (length=71) Species: 224324 (Aquifex aeolicus VF5)

HMPYKLQESFLNTARKKRVKVSVYLVNGVRLQGRIRSFDLFTILLEDGKQ
QTLVYKHAITTIVPHERLEIE

3D structure

• PDB: 5sze Crystal structure and RNA-binding properties of an Hfq homolog from the deep-branching Aquificae: conservation of the lateral RNA-binding mode.
• Chain: A
• Resolution: 1.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	N14 R17 S39 F40	N12 R15 S37 F38	PDBbind-CN: Kd=21.3nM

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0043487 regulation of RNA stability
• GO:0045974 regulation of translation, ncRNA-mediated

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:5sze, PDBe:5sze, PDBj:5sze
• PDBsum: 5sze
• PubMed: 28375142
• UniProt: O66512|HFQ_AQUAE RNA-binding protein Hfq (Gene Name=hfq)