Structure of PDB 5svi Chain A

Receptor sequence
>5sviA (length=46) Species: 9606 (Homo sapiens) [Search protein sequence]
SDQTWVQCDACLKWRKLPDGMLPEKWYCSNNPDPQFRNCEVPEEPE
3D structure
PDB5svi Multivalent Chromatin Engagement and Inter-domain Crosstalk Regulate MORC3 ATPase.
ChainA
Resolution1.613 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A S0 D407 Q408 T409 W410 V411 Q412 W419 D424 P430 E431 E453 S1 D2 Q3 T4 W5 V6 Q7 W14 D19 P23 E24 E46
BS02 ZN A C413 C416 C435 C446 C8 C11 C28 C39
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:5svi, PDBe:5svi, PDBj:5svi
PDBsum5svi
PubMed27653685
UniProtQ14149|MORC3_HUMAN MORC family CW-type zinc finger protein 3 (Gene Name=MORC3)

[Back to BioLiP]