Structure of PDB 5suv Chain A

Receptor sequence

>5suvA (length=126) Species: 272831 (Neisseria meningitidis FAM18)

AMIYGIGTDIVSLKRIIRLNKKFGQAFAGRILTPEELLEFPQAGKPVNYL
AKRFAAKEAFAKAVGTGIRGAVSFRNIGIGHDALGKPEFFYGPALSKWLE
EQGISRVSLSMSDEEDTVLAFVVAEK

3D structure

• PDB: 5suv Crystal structure of holo-[acyl-carrier-protein] synthase (AcpS) from Neisseria meningitidis in complex with Coenzyme A
• Chain: A
• Resolution: 1.75 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K61 D112
• Catalytic site (residue number reindexed from 1): K62 D113
• Enzyme Commision number: 2.7.8.7: holo-[acyl-carrier-protein] synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	COA	A	K61 G64 T65 G66 I67 F73	K62 G65 T66 G67 I68 F74
BS02	COA	A	K51 H80 G84 K85 P86 M110	K52 H81 G85 K86 P87 M111

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0008897 holo-[acyl-carrier-protein] synthase activity
• GO:0016740 transferase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006633 fatty acid biosynthetic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5suv, PDBe:5suv, PDBj:5suv
• PDBsum: 5suv
• UniProt: A1KVH5|ACPS_NEIMF Holo-[acyl-carrier-protein] synthase (Gene Name=acpS)