Structure of PDB 5sup Chain A

Receptor sequence

>5supA (length=383) Species: 559292 (Saccharomyces cerevisiae S288C)

TGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLG
KTAVFVLSTLQQLDPVPGEVAVVVICNARELAYQIRNEYLRFSKYMPDVK
TAVFYGGTPISKDAELLKNKDTAPHIVVATPGRLKALVREKYIDLSHVKN
FVIDECDKVLEELDMRRDVQEIFRATPRDKQVMMFSATLSQEIRPICRRF
LQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRKLAQLLDDLEFNQVII
FVKSTTRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICV
STDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVS
SKEDEEVLAKIQERFDVKIAEFPEEGIDPSTYL

3D structure

• PDB: 5sup Structural and biochemical analyses of the DEAD-box ATPase Sub2 in association with THO or Yra1.
• Chain: A
• Resolution: 2.6 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.13: RNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	R227 R228 Q231 F234 R235 T237 P238 R239 R260 F261 Q263	R166 R167 Q170 F173 R174 T176 P177 R178 R199 F200 Q202
BS02	rna	A	A139 R140 G167 G168 T191 G193 R194 E223 S315 T316 H337 G338 R345 T363 V365	A78 R79 G106 G107 T130 G132 R133 E162 S254 T255 H276 G277 R284 T302 V304
BS03	ADP	A	F82 Q89 G109 G111 K112 T113 D371 F400	F21 Q28 G48 G50 K51 T52 D310 F339
BS04	BEF	A	S108 K112 R396 R399	S47 K51 R335 R338

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003724 RNA helicase activity
• GO:0005524 ATP binding

External links

• PDB: RCSB:5sup, PDBe:5sup, PDBj:5sup
• PDBsum: 5sup
• PubMed: 28059701
• UniProt: Q07478|SUB2_YEAST ATP-dependent RNA helicase SUB2 (Gene Name=SUB2)