Structure of PDB 5qxy Chain A |
>5qxyA (length=130) Species: 9606 (Homo sapiens) [Search protein sequence] |
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYRTVIKEP MDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRA CALRDTAYAIIKEELDEDFEQLCEEIQESR |
|
PDB | 5qxy PanDDA analysis group deposition - Bromodomain of human ATAD2 fragment screening |
Chain | A |
Resolution | 1.54 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
RK7 |
A |
H998 I1035 |
H20 I57 |
|
|
|