Structure of PDB 5oug Chain A

Receptor sequence

>5ougA (length=205) Species: 9606 (Homo sapiens)

GEFQRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVD
VVIWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWKPDILLYNAIERPEV
LTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHS
RELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVT
FRKKG

3D structure

• PDB: 5oug An allosteric binding site of the alpha 7 nicotinic acetylcholine receptor revealed in a humanized acetylcholine-binding protein.
• Chain: A
• Resolution: 2.57 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	L0B	A	W53 L104 L106 Q114 L116	W54 L105 L107 Q115 L117
BS02	9Z0	A	L54 I88 R96	L55 I89 R97	PDBbind-CN: -logKd/Ki=2.77,Kd=1703.44uM
BS03	9Z0	A	Y7 E9 L10 L63 Q64 Y70 V107	Y8 E10 L11 L64 Q65 Y71 V108	PDBbind-CN: -logKd/Ki=2.77,Kd=1703.44uM
BS04	L0B	A	Y91 W145 T146 C186	Y92 W146 T147 C187
BS05	9Z0	A	L100 T101	L101 T102	PDBbind-CN: -logKd/Ki=2.77,Kd=1703.44uM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Nov 28 16:16:39 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5oug', asym_id = 'A', title = 'An allosteric binding site of the alpha 7 nicoti...led in a humanized acetylcholine-binding protein.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5oug', asym_id='A', title='An allosteric binding site of the alpha 7 nicoti...led in a humanized acetylcholine-binding protein.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004888,0005216,0005230,0006811,0016020,0022848,0034220,0045211', uniprot = '', pdbid = '5oug', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004888,0005216,0005230,0006811,0016020,0022848,0034220,0045211', uniprot='', pdbid='5oug', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>