Structure of PDB 5otw Chain A

Receptor sequence
>5otwA (length=100) Species: 9606 (Homo sapiens) [Search protein sequence]
TVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPG
SFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEE
3D structure
PDB5otw alpha-Helix or beta-Turn? An Investigation into N-Terminally Constrained Analogues of Glucagon-like Peptide 1 (GLP-1) and Exendin-4.
ChainA
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A L32 T35 V36 W39 E68 Y69 Y88 E128 L4 T7 V8 W11 E40 Y41 Y60 E100
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004967 glucagon receptor activity
GO:0008528 G protein-coupled peptide receptor activity
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5otw, PDBe:5otw, PDBj:5otw
PDBsum5otw
PubMed29877701
UniProtP43220|GLP1R_HUMAN Glucagon-like peptide 1 receptor (Gene Name=GLP1R)

[Back to BioLiP]