Structure of PDB 5opa Chain A

Receptor sequence
>5opaA (length=393) Species: 83331 (Mycobacterium tuberculosis CDC1551) [Search protein sequence]
TVLLEVPFSARGDRIPDAVAELRTREPIRKVRTITGAEAWLVSSYALCTQ
VLEDRRFSMKETAAAGAPRLNALTVPPEVVNNMGNIADAGLRKAVMKAIT
PKAPGLEQFLRDTANSLLDNLITEGAPADLRNDFADPLATALHCKVLGIP
QEDGPKLFRSLSIAFMSSADPIPAAKINWDRDIEYMAGILENPNITTGLM
GELSRLRKDPAYSHVSDELFATIGVTFFGAGVISTGSFLTTALISLIQRP
QLRNLLHEKPELIPAGVEELLRINLSFADGLPRLATADIQVGDVLVRKGE
LVLVLLEGANFDPEHFPNPGSIELDRPNPTSHLAFGRGQHFCPGSALGRR
HAQIGIEALLKKMPGVDLAVPIDQLVWRTRFQRRIPERLPVLW
3D structure
PDB5opa Novel Aryl Substituted Pyrazoles as Small Molecule Inhibitors of Cytochrome P450 CYP121A1: Synthesis and Antimycobacterial Evaluation.
ChainA
Resolution1.345 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) S170 A233 I236 S237 T238 C345 P346 G347 H354 R386
Catalytic site (residue number reindexed from 1) S167 A230 I233 S234 T235 C342 P343 G344 H351 R383
Enzyme Commision number 1.14.19.70: mycocyclosin synthase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM A M62 M86 H146 F230 G234 S237 F241 F280 L284 R286 A337 F338 H343 C345 P346 G347 M59 M83 H143 F227 G231 S234 F238 F277 L281 R283 A334 F335 H340 C342 P343 G344
BS02 A2W A V78 N85 L164 A167 F168 W182 V228 T229 G232 Q385 V75 N82 L161 A164 F165 W179 V225 T226 G229 Q382 MOAD: Kd=4.16uM
Gene Ontology
Molecular Function
GO:0004497 monooxygenase activity
GO:0005506 iron ion binding
GO:0008395 steroid hydroxylase activity
GO:0009975 cyclase activity
GO:0016491 oxidoreductase activity
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0016717 oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water
GO:0020037 heme binding
GO:0036199 cholest-4-en-3-one 26-monooxygenase activity
GO:0046872 metal ion binding
GO:0070025 carbon monoxide binding
Biological Process
GO:0006707 cholesterol catabolic process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5opa, PDBe:5opa, PDBj:5opa
PDBsum5opa
PubMed29185746
UniProtP9WPP7|CP121_MYCTU Mycocyclosin synthase (Gene Name=cyp121)

[Back to BioLiP]