Structure of PDB 5ocj Chain A

Receptor sequence

>5ocjA (length=275) Species: 83332 (Mycobacterium tuberculosis H37Rv)

VEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFE
EYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWL
QANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGW
WPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWV
YCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPN
GTHSWPYWNEQLVAMKADIQHVLNG

3D structure

• PDB: 5ocj Cyclipostins and cyclophostin analogs inhibit the antigen 85C from
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.122: trehalose O-mycolyltransferase.
  2.3.1.20: diacylglycerol O-acyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	9SW	A	L40 S124 W265	L33 S117 W258	PDBbind-CN: -logKd/Ki=4.82,IC50=15uM
BS02	9SW	A	I222 P223 F226	I215 P216 F219	PDBbind-CN: -logKd/Ki=4.82,IC50=15uM

Gene Ontology

Molecular Function

• GO:0004144 diacylglycerol O-acyltransferase activity
• GO:0016746 acyltransferase activity
• GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
• GO:0035375 zymogen binding
• GO:0050348 trehalose O-mycolyltransferase activity

Biological Process

• GO:0006869 lipid transport
• GO:0009247 glycolipid biosynthetic process
• GO:0046677 response to antibiotic
• GO:0071769 mycolate cell wall layer assembly

Cellular Component

• GO:0005576 extracellular region
• GO:0009274 peptidoglycan-based cell wall

External links

• PDB: RCSB:5ocj, PDBe:5ocj, PDBj:5ocj
• PDBsum: 5ocj
• PubMed: 29301937
• UniProt: P9WQN9|A85C_MYCTU Diacylglycerol acyltransferase/mycolyltransferase Ag85C (Gene Name=fbpC)