Structure of PDB 5oc0 Chain A

Receptor sequence

>5oc0A (length=174) Species: 83333 (Escherichia coli K-12)

ENKYSRLQISIHWLVFLLVIAAYCAMEFRGFFPRSDRPLINMIHVSCGIS
ILVLMVVRLLLRLKYPTPPIIPKPKPMMTGLAHLGHLVIYLLFIALPVIG
LVMMYNRGNPWFAFGLTMPYASEANFERVDSLKSWHETLANLGYFVIGLH
AAAALAHHYFWKDNTLLRMMPRKR

3D structure

• PDB: 5oc0 Scavenging of superoxide by a membrane-bound superoxide oxidase.
• Chain: A
• Resolution: 1.97 Å

Enzymatic activity

• Enzyme Commision number: 1.10.3.17: superoxide oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	Y5 H13 W14 F17 R59 R63 H87 I90 Y91 F94 H151 A155 R169 M170	Y4 H12 W13 F16 R58 R62 H86 I89 Y90 F93 H150 A154 R168 M169
BS02	HEM	A	Y24 M27 H45 V46 G49 I52 L97 P98 G101 L102 M105 R108 W112 K134 H137 A141	Y23 M26 H44 V45 G48 I51 L96 P97 G100 L101 M104 R107 W111 K133 H136 A140
BS03	MG	A	R63 L64 Y66	R62 L63 Y65
BS04	37X	A	F32 P34 D37	F31 P33 D36

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0019430 removal of superoxide radicals
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:5oc0, PDBe:5oc0, PDBj:5oc0
• PDBsum: 5oc0
• PubMed: 29915379
• UniProt: P0ABE5|C561_ECOLI Superoxide oxidase CybB (Gene Name=cybB)