Structure of PDB 5o9f Chain A

Receptor sequence

>5o9fA (length=346) Species: 1925550 (Rhodococcus sp. M8)

MKAVQYTEIGSEPVVVDIPTPTPGPGEILLKVTAAGLCYSDISVMDMPAA
QYAYGLPLTLGHEGVGTVAELGEGVTGFGVGDAVAVYGPWGCGACHACAR
GRENYCTRAADLGITPPGLGSPGSMAEYMIVDSARHLVPIGDLDPVAAAP
LTDAGLTPYHAISRVLPLLGPGSTAVVIGVGGLGHVGIQILRAVSAARVI
AVDLDDDRLALAREVGADAAVKSGAGAADAIRELTGGQGATAVFDFVGAQ
STIDTAQQVVAVDGHISVVGIHAGAHAKVGFFMIPFGASVVTPFAGTRSE
LMEVVALARAGRLDIHTETFTLDEGPAAYRRLREGSIRGRGVVVPT

3D structure

• PDB: 5o9f Relaxation of nonproductive binding and increased rate of coenzyme release in an alcohol dehydrogenase increases turnover with a nonpreferred alcohol enantiomer.
• Chain: A
• Resolution: 1.64 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C92 C95 C98 C106	C92 C95 C98 C106
BS02	ZN	A	C38 H62 D153	C38 H62 D153
BS03	NAD	A	C38 Y39 S40 D153 T157 V180 G181 G182 L183 D203 L204 R208 S223 F246 V247 T252 V269 G270 I271 F294 R340	C38 Y39 S40 D153 T157 V180 G181 G182 L183 D203 L204 R208 S223 F246 V247 T252 V269 G270 I271 F294 R340
BS04	9ON	A	S40 H62 L119	S40 H62 L119

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu May 8 10:32:54 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1471                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1472         else:

=> 1473             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1474     

   1475     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5o9f', asym_id = 'A', title = 'Relaxation of nonproductive binding and increase...turnover with a nonpreferred alcohol enantiomer. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5o9f', asym_id='A', title='Relaxation of nonproductive binding and increase...turnover with a nonpreferred alcohol enantiomer. ')

    840 

    841     if go:

=>  842         display_go(go,uniprot,pdbid,asym_id)

    843     return pubmed,uniprot

    844 

global display_go = <function display_go>, go = '0008270,0016491', uniprot = '', pdbid = '5o9f', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0008270,0016491', uniprot='', pdbid='5o9f', asym_id='A')

    481         '''.replace("$namespace_link",namespace_link

    482           ).replace("$namespace",namespace

=>  483           ).replace("$uniprot",u

    484         ))

    485         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>