Structure of PDB 5o5w Chain A

Receptor sequence

>5o5wA (length=244) Species: 322710 (Azotobacter vinelandii DJ)

RPIRLLPWLQVVKIGGRVMDRGADAILPLVEELRKLLPEHRLLILTGAGV
RARHVFSVGLDLGLPVGSLAPLAASEAGQNGHILAAMLASEGVSYVEHPT
VADQLAIHLSATRAVVGSAFPPYHHHEFPGSRIPPHRADTGAFLLADAFG
AAGLTIVENVDGIYTADPNGPDRGQARFLPETSATDLAKSEGPLPVDRAL
LDVMATARHIERVQVVNGLVPGRLTAALRGEHVGTLIRTGVRPA

3D structure

• PDB: 5o5w Serial millisecond crystallography for routine room-temperature structure determination at synchrotrons.
• Chain: A
• Resolution: 1.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	A	K45 G47 G48 R49 A80 E190 N191 V192 Y196 D199 P200 N201 P225 L226 P227	K13 G15 G16 R17 A48 E158 N159 V160 Y164 D167 P168 N169 P193 L194 P195
BS02	MG	A	E190 P227	E158 P195
BS03	8M0	A	A106 S107 G110 Q111 H114 Y127 E129 H130 P131 S150 P154 H156	A74 S75 G78 Q79 H82 Y95 E97 H98 P99 S118 P122 H124
BS04	8M0	A	H156 H157 H158	H124 H125 H126

Gene Ontology

Molecular Function

• GO:0030151 molybdenum ion binding
• GO:0045735 nutrient reservoir activity
• GO:0046872 metal ion binding

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5o5w, PDBe:5o5w, PDBj:5o5w
• PDBsum: 5o5w
• PubMed: 28912485
• UniProt: P84308|MOSA_AZOVD Molybdenum storage protein subunit alpha (Gene Name=mosA)