Structure of PDB 5o4t Chain A |
>5o4tA (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] |
EMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFF TMKQNLEAYRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGG AVLRQARRQAEKM |
|
PDB | 5o4t Structure-based discovery of selective BRPF1 bromodomain inhibitors. |
Chain | A |
Resolution | 1.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
9KT |
A |
V662 Y707 N708 F714 |
V36 Y81 N82 F88 |
PDBbind-CN: -logKd/Ki=3.40,IC50>400uM BindingDB: IC50=>400000nM |
|
|