Structure of PDB 5o10 Chain A

Receptor sequence
>5o10A (length=104) Species: 9606 (Homo sapiens) [Search protein sequence]
GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSHTA
ANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKK
ATNE
3D structure
PDB5o10 Heightened Dynamics of the Oxidized Y48H Variant of Human Cytochrome c Increases Its Peroxidatic Activity.
ChainA
Resolution1.36 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEC A K13 C14 C17 H18 G29 P30 L35 G41 Y46 H48 T49 N52 W59 L68 T78 K79 M80 K13 C14 C17 H18 G29 P30 L35 G41 Y46 H48 T49 N52 W59 L68 T78 K79 M80
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
GO:0006123 mitochondrial electron transport, cytochrome c to oxygen
GO:0006915 apoptotic process
GO:0045333 cellular respiration
GO:0097193 intrinsic apoptotic signaling pathway
GO:0097194 execution phase of apoptosis
Cellular Component
GO:0005634 nucleus
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005758 mitochondrial intermembrane space
GO:0005829 cytosol
GO:0043293 apoptosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5o10, PDBe:5o10, PDBj:5o10
PDBsum5o10
PubMed29083920
UniProtP99999|CYC_HUMAN Cytochrome c (Gene Name=CYCS)

[Back to BioLiP]