Structure of PDB 5nw3 Chain A |
>5nw3A (length=54) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence] |
MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFE KLED |
|
PDB | 5nw3 The cryofrozen atomic resolution X-ray crystal structure of perdeuterated Pyrococcus furiosus Rubredoxin (100K, 0.59A resolution) |
Chain | A |
Resolution | 0.59 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
A |
C5 C8 C38 C41 |
C6 C9 C39 C42 |
|
|
|
|