Structure of PDB 5nv2 Chain A |
>5nv2A (length=133) Species: 9606 (Homo sapiens) [Search protein sequence] |
SEYQDGKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMSGMRWVQWF GDGKFSEVSADKLVALGLFSQHFNLATFNKLVSYRKAMYHALEKARVRAG KTFPSSLEDQLKPMLEWAHGGFKPTGIEGLKPN |
|
PDB | 5nv2 Targeting PWWP domain of DNA methyltransferase 3B for epigenetic cancer therapy: Identification and structural characterization of new potential protein-protein interaction inhibitors |
Chain | A |
Resolution | 2.029 Å |
3D structure |
|
|
Enzyme Commision number |
2.1.1.37: DNA (cytosine-5-)-methyltransferase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
9AE |
A |
I233 F236 W239 D266 |
I19 F22 W25 D52 |
|
|
|