Structure of PDB 5nl0 Chain A

Receptor sequence
>5nl0A (length=98) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
3D structure
PDB5nl0 Structure and Dynamics of a 197 bp Nucleosome in Complex with Linker Histone H1.
ChainA
Resolution5.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A R42 P43 T45 R72 R83 F84 Q85 V117 T118 R5 P6 T8 R35 R46 F47 Q48 V80 T81
BS02 dna A R40 Y41 G44 T45 V46 A47 R49 K64 L65 P66 R69 R83 R3 Y4 G7 T8 V9 A10 R12 K27 L28 P29 R32 R46
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5nl0, PDBe:5nl0, PDBj:5nl0
PDBsum5nl0
PubMed28475873
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]