Structure of PDB 5nc0 Chain A

Receptor sequence

>5nc0A (length=125) Species: 85698 (Achromobacter xylosoxidans)

QFAKPEDAVKYRQSAGTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKT
LSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAG
DLDKLRAAFGDVGASCKACHDAYRK

3D structure

• PDB: 5nc0 Distinguishing Nitro vs Nitrito Coordination in Cytochrome c' Using Vibrational Spectroscopy and Density Functional Theory.
• Chain: A
• Resolution: 0.91 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	Q13 G16 M19 A20 W56 F59 Q83 F86 C116 C119 H120 R124	Q13 G16 M19 A20 W56 F59 Q83 F86 C116 C119 H120 R124
BS02	NO2	A	R12 G16 F59	R12 G16 F59
BS03	NO2	A	Q81 Q84	Q81 Q84

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0022900 electron transport chain

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:5nc0, PDBe:5nc0, PDBj:5nc0
• PDBsum: 5nc0
• PubMed: 29053273
• UniProt: P00138|CYCP_ALCXX Cytochrome c'