Structure of PDB 5n2s Chain A

Receptor sequence
>5n2sA (length=383) Species: 562,9606 [Search protein sequence]
DLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDK
SPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAY
IQKSAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLA
VADVLVGALVIPLAILINIGPQTYFHTCLMVACPVLILAQSSILALLAIA
VDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAV
ERAWAAAGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLE
VFALIRKQLPQKYYGKELKIAKSAALIAFLFALSWLPLHILNCITLFCPS
CHKPSILTYIAIFLAHGNSAMNPIVYAFRIQKF
3D structure
PDB5n2s Structures of Human A1 and A2A Adenosine Receptors with Xanthines Reveal Determinants of Selectivity.
ChainA
Resolution3.303 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 8K8 A V1192 A1196 F1276 E1277 W1352 L1355 H1356 N1359 I1379 V185 A189 F269 E270 W335 L338 H339 N342 I362
Gene Ontology
Molecular Function
GO:0001609 G protein-coupled adenosine receptor activity
GO:0001664 G protein-coupled receptor binding
GO:0001883 purine nucleoside binding
GO:0004930 G protein-coupled receptor activity
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0031072 heat shock protein binding
GO:0031683 G-protein beta/gamma-subunit complex binding
GO:0032795 heterotrimeric G-protein binding
GO:0044877 protein-containing complex binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0001659 temperature homeostasis
GO:0001666 response to hypoxia
GO:0001973 G protein-coupled adenosine receptor signaling pathway
GO:0002087 regulation of respiratory gaseous exchange by nervous system process
GO:0002674 negative regulation of acute inflammatory response
GO:0002686 negative regulation of leukocyte migration
GO:0002793 positive regulation of peptide secretion
GO:0003084 positive regulation of systemic arterial blood pressure
GO:0003085 negative regulation of systemic arterial blood pressure
GO:0003093 regulation of glomerular filtration
GO:0006612 protein targeting to membrane
GO:0006909 phagocytosis
GO:0006954 inflammatory response
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007267 cell-cell signaling
GO:0007399 nervous system development
GO:0008285 negative regulation of cell population proliferation
GO:0014050 negative regulation of glutamate secretion
GO:0014074 response to purine-containing compound
GO:0016042 lipid catabolic process
GO:0022900 electron transport chain
GO:0032229 negative regulation of synaptic transmission, GABAergic
GO:0032244 positive regulation of nucleoside transport
GO:0032900 negative regulation of neurotrophin production
GO:0042311 vasodilation
GO:0042321 negative regulation of circadian sleep/wake cycle, sleep
GO:0042323 negative regulation of circadian sleep/wake cycle, non-REM sleep
GO:0043066 negative regulation of apoptotic process
GO:0043268 positive regulation of potassium ion transport
GO:0043410 positive regulation of MAPK cascade
GO:0045776 negative regulation of blood pressure
GO:0045777 positive regulation of blood pressure
GO:0046888 negative regulation of hormone secretion
GO:0050728 negative regulation of inflammatory response
GO:0050890 cognition
GO:0050900 leukocyte migration
GO:0050965 detection of temperature stimulus involved in sensory perception of pain
GO:0050995 negative regulation of lipid catabolic process
GO:0050996 positive regulation of lipid catabolic process
GO:0051930 regulation of sensory perception of pain
GO:0051967 negative regulation of synaptic transmission, glutamatergic
GO:0055089 fatty acid homeostasis
GO:0055117 regulation of cardiac muscle contraction
GO:0060079 excitatory postsynaptic potential
GO:0060292 long-term synaptic depression
GO:0070254 mucus secretion
GO:0070256 negative regulation of mucus secretion
GO:0070328 triglyceride homeostasis
GO:0086004 regulation of cardiac muscle cell contraction
GO:0097190 apoptotic signaling pathway
GO:0099509 regulation of presynaptic cytosolic calcium ion concentration
GO:1900272 negative regulation of long-term synaptic potentiation
GO:1900453 negative regulation of long-term synaptic depression
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0016323 basolateral plasma membrane
GO:0030425 dendrite
GO:0030673 axolemma
GO:0032279 asymmetric synapse
GO:0042597 periplasmic space
GO:0042734 presynaptic membrane
GO:0043025 neuronal cell body
GO:0043195 terminal bouton
GO:0043197 dendritic spine
GO:0044297 cell body
GO:0044305 calyx of Held
GO:0045202 synapse
GO:0045211 postsynaptic membrane
GO:0048786 presynaptic active zone

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5n2s, PDBe:5n2s, PDBj:5n2s
PDBsum5n2s
PubMed28712806
UniProtP0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC);
P30542

[Back to BioLiP]