Structure of PDB 5n10 Chain A

Receptor sequence
>5n10A (length=231) Species: 9606 (Homo sapiens) [Search protein sequence]
MDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKN
VVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLEL
LDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQ
EAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAI
AELDTLNEESYKDSTLIMQLLRDNLTLWTSE
3D structure
PDB5n10 A Binary Bivalent Supramolecular Assembly Platform Based on Cucurbit[8]uril and Dimeric Adapter Protein 14-3-3.
ChainA
Resolution1.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A R58 R62 K122 R129 Y130 L174 N175 V178 E182 L222 N226 R56 R60 K120 R127 Y128 L172 N173 V176 E180 L220 N224
BS02 C8L A L229 S232 E233 L227 S230 E231
Gene Ontology
Molecular Function
GO:0004860 protein kinase inhibitor activity
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0019904 protein domain specific binding
GO:0042802 identical protein binding
GO:0042826 histone deacetylase binding
GO:0045296 cadherin binding
GO:0050815 phosphoserine residue binding
GO:0051219 phosphoprotein binding
Biological Process
GO:0006605 protein targeting
GO:0007165 signal transduction
GO:0008104 protein localization
GO:0043085 positive regulation of catalytic activity
GO:0045744 negative regulation of G protein-coupled receptor signaling pathway
GO:0051220 cytoplasmic sequestering of protein
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005773 vacuole
GO:0005774 vacuolar membrane
GO:0005829 cytosol
GO:0005925 focal adhesion
GO:0016020 membrane
GO:0042470 melanosome
GO:0048471 perinuclear region of cytoplasm
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5n10, PDBe:5n10, PDBj:5n10
PDBsum5n10
PubMed28510303
UniProtP31946|1433B_HUMAN 14-3-3 protein beta/alpha (Gene Name=YWHAB)

[Back to BioLiP]