Structure of PDB 5n0u Chain A

Receptor sequence

>5n0uA (length=391) Species: 72120 (Omphalotus olearius)

KAGSLTIVGTGIESIGQMTLQALSYIEAAAKVFYCVIDPATEAFILTKNK
NCVDLYQYYDNGKSALNTYTQMSELMVREVRKGLDVVGVFYGHPGVFVNP
SHRALAIAKSEGYRARMLPGVSAEDCLFADLCIDPSNPGCLTYEASDFLI
RDRPVSIHSHLVLFQVGCVGIADFNFTGFDNNKFGVLVDRLEQEYGAEHP
VVHYIAAMMPHQDPVTDKYTVAQLREPEIAKRVGGVSTFYIPPKARKASN
LDIIRRLELLPAGQVPDKKARIYPANQWEPDVPEVEPYRPSDQAAIAQLA
DHAPPEQYQPLATSKAMSDVMTKLALDPKALADYKADHRAFAQSVPDLTP
QERAALELGDSWAIRCAMKNMPSSLLDAARPWVIVVGVIGV

3D structure

• PDB: 5n0u A molecular mechanism for the enzymatic methylation of nitrogen atoms within peptide bonds.
• Chain: A
• Resolution: 1.68 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SAH	A	Y98 G99 H100 V103 S129 A130 F171 Q172 Y211 I212 A213 M215 G242 V243 S244 T245	Y91 G92 H93 V96 S122 A123 F164 Q165 Y204 I205 A206 M208 G235 V236 S237 T238
BS02	MG	A	S21 P217	S14 P210
BS03	MG	A	S166 Y202 I248 P249 P250	S159 Y195 I241 P242 P243
BS04	MG	A	S31 A332 L333 P335	S24 A325 L326 P328
BS05	MG	A	G102 H109	G95 H102

Gene Ontology

Molecular Function

• GO:0008168 methyltransferase activity

Biological Process

• GO:0032259 methylation

External links

• PDB: RCSB:5n0u, PDBe:5n0u, PDBj:5n0u
• PDBsum: 5n0u
• PubMed: 30151425
• UniProt: A0A2R2JFI5|OPHMA_OMPOL Methyltransferase/ribosomally synthesized cyclic peptide omphalotin A precursor ophMA (Gene Name=ophMA)