Structure of PDB 5mwt Chain A

Receptor sequence

>5mwtA (length=133) Species: 9606 (Homo sapiens) [Search protein sequence]

CGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNA
HGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLP
DGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD

3D structure

PDB

5mwt Structural insights into the redesign of a sucrose phosphorylase by induced loop repositioning

Chain

Resolution

1.711 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	JB9	A	V31 H44 R48 N61 E71 R73 D123 G124 D125	V30 H43 R47 N60 E70 R72 D122 G123 D124

Gene Ontology

	Biological Process
GO:0002317	plasma cell differentiation
GO:0006915	apoptotic process
GO:0007165	signal transduction
GO:0031295	T cell costimulation
GO:0042981	regulation of apoptotic process
GO:0043065	positive regulation of apoptotic process
GO:0043123	positive regulation of canonical NF-kappaB signal transduction
GO:0045445	myoblast differentiation
GO:0046598	positive regulation of viral entry into host cell
GO:0050729	positive regulation of inflammatory response
GO:0098609	cell-cell adhesion
GO:2000329	negative regulation of T-helper 17 cell lineage commitment
GO:2001200	positive regulation of dendritic cell differentiation

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005737	cytoplasm
GO:0005788	endoplasmic reticulum lumen
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0062023	collagen-containing extracellular matrix
GO:0070062	extracellular exosome
GO:1990724	galectin complex

External links

PDB	RCSB:5mwt, PDBe:5mwt, PDBj:5mwt
PDBsum	5mwt
PubMed
UniProt	P09382\|LEG1_HUMAN Galectin-1 (Gene Name=LGALS1)