Structure of PDB 5mwl Chain A

Receptor sequence

>5mwlA (length=421) Species: 10090 (Mus musculus)

KMDENEWSYHGEGNKSLVVAHAQRCVVLRFLKFPPNKKKTSEEILQHLQN
IVDFGKNVMKDFLGENYVHCGEVVQLPLEFVKQLCLKIQCERPEKDLDTF
SGYAMCLPNLTRLQTFHFAEHRPILCVEIKPKCGFIPFSNDVTHEMKHKV
CRYCMHQHLKVATGKWKKISKYCPLDLYSGNKQRMHFALRSLLQETQNNL
RIFKNGELIYGCPVADLKELAHHLKPFFFPSNGLASGPHCTKAVIRELVH
VITRVLLSSSEKARAGALRLGLQGPRVCEASPGLPKGCLLYKTLQVQMLD
QLDIEGLYPLYKRVEQYLEEFPEERKTLQIDGPYDEVFYQKLLDLSTEDD
GTVAFALTKVQQYRVAMTAKDCSIMIALSPCLQSRLAFSVSVLDLDLKPY
ESIPHQYKLDSKIVNYYSKTV

3D structure

• PDB: 5mwl The crystal structure of mammalian inositol 1,3,4,5,6-pentakisphosphate 2-kinase reveals a new zinc-binding site and key features for protein function.
• Chain: A
• Resolution: 3.2 Å

Enzymatic activity

• Enzyme Commision number: 2.7.1.158: inositol-pentakisphosphate 2-kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	A	H14 G17 K19 S20 V22 P116 L118 E136 R209 L436 D437	H10 G13 K15 S16 V18 P108 L110 E128 R201 L393 D394
BS02	5MY	A	N18 K19 K138 K140 H164 N206 D400 K441 Q449 L452	N14 K15 K130 K132 H156 N198 D371 K398 Q406 L409
BS03	ZN	A	C162 C181 C291	C154 C173 C278
BS04	ZN	A	H125 H129 C410	H117 H121 C381
BS05	MG	A	K19 D439	K15 D396
BS06	MG	A	S402 D437	S373 D394

Gene Ontology

Molecular Function

• GO:0005524 ATP binding
• GO:0016301 kinase activity
• GO:0035299 inositol-1,3,4,5,6-pentakisphosphate 2-kinase activity

Biological Process

• GO:0016310 phosphorylation

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:5mwl, PDBe:5mwl, PDBj:5mwl
• PDBsum: 5mwl
• PubMed: 28450399
• UniProt: Q6P1C1|IPPK_MOUSE Inositol-pentakisphosphate 2-kinase (Gene Name=Ippk)