Structure of PDB 5mtt Chain A

Receptor sequence

>5mttA (length=373) Species: 543734 (Lacticaseibacillus casei BL23)

NVSGSVKLWVDTTQVPYYKKIVANFNKKYPDVKVKVTQSPNGSANAKTDV
GKDPAKAADVFEVANDQLGSMAEAGYINPLSPDATKAVKNNNVAVASEGV
TWKGKMFAYPFAEQAQTIYYNKSKLTADDVKTWDGLTAKGVLATDFTNAY
NFYPVFLSAGTQLYGKTGETVKGTDVNSAKGEQAMAWFAQQKSNKGVMQT
SNALNQLKSGKAAAILDGPWNSANIKKILGKNFAVAPYPTIKLDGKDVQM
QAFLGIETFAVNSHASGSNQKAAATLASFITNKESQLIVYDHSGQIPVDK
TAQKSSKVASDPVAGAVMTMAKPGNSTLMPKMPQMATFWNDAAPLINGAY
TGSIPASQYSTKLDTFVKNISKA

3D structure

• PDB: 5mtt Inducer exclusion in Firmicutes: insights into the regulation of a carbohydrate ATP binding cassette transporter from Lactobacillus casei BL23 by the signal transducing protein P-Ser46-HPr.
• Chain: A
• Resolution: 1.12 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GLC	A	Q128 Y164 W234	Q114 Y150 W220
BS02	GLC	A	A58 K61 D80 N162 Y164 W353	A44 K47 D66 N148 Y150 W339
BS03	GLC	A	A58 N59 K61 W353 N354	A44 N45 K47 W339 N340
BS04	GLC	A	K61 D80 Q81 N162 Y164 W353	K47 D66 Q67 N148 Y150 W339
BS05	GLC	A	Q128 Y164 W234	Q114 Y150 W220
BS06	GLC	A	D25 W234	D11 W220
BS07	GLC	A	D25 T26 N55 G56 A58	D11 T12 N41 G42 A44

Gene Ontology

Molecular Function

• GO:1901982 maltose binding

Biological Process

• GO:0015768 maltose transport
• GO:0042956 maltodextrin transmembrane transport

Cellular Component

• GO:0055052 ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing

External links

• PDB: RCSB:5mtt, PDBe:5mtt, PDBj:5mtt
• PDBsum: 5mtt
• PubMed: 28370477
• UniProt: B0L7B0