Structure of PDB 5mjh Chain A

Receptor sequence

>5mjhA (length=368) Species: 1200984 (Streptomyces lividans 1326)

TPLTSLGSEQAMFHGKHQPGITTPMQARGHLVAFDLAAGAGRKEAAALLR
RWSDTARRLMAGEPAGSRDTDVARDAGPSSLTVTFGFGHSFFGRTGLEKQ
RPVALDPLPDFSSDHLDKNRSNGDLWVQIGADDALVAFHALRAIQRDAGA
AARVRWQMNGFNRSPGATAHPMTARNLMGQVDGTRNPKPGEADFDRRIFV
PEGPAWMANGSYVVVRRIRMLLDDWEELSLKAQEDVIGRRKSDGAPLSGG
SGATESTEMDLEKTDGSGELVVPINAHARITRPDQNGGAAMVRRPFSYHD
GFDADGVPDAGLLFVCWQADPLRGFVPVQRKLDRGDALSQFIRHEASGLF
AVPGGAAEGEYVGQRLLE

3D structure

• PDB: 5mjh Photoreduction and validation of haem-ligand intermediate states in protein crystals by in situ single-crystal spectroscopy and diffraction.
• Chain: A
• Resolution: 1.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	Q249 V250 G252 T253 R254 I294 H353 T357 R358 R369 F390 F401 V404 Q405 L414	Q180 V181 G183 T184 R185 I218 H277 T281 R282 R293 F314 F325 V328 Q329 L338
BS02	OXY	A	D251 R369	D182 R293

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 29 08:56:08 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5mjh', asym_id = 'A', title = 'Photoreduction and validation of haem-ligand int...itu single-crystal spectroscopy and diffraction. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5mjh', asym_id='A', title='Photoreduction and validation of haem-ligand int...itu single-crystal spectroscopy and diffraction. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004601,0020037,0033212', uniprot = '', pdbid = '5mjh', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004601,0020037,0033212', uniprot='', pdbid='5mjh', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>