Structure of PDB 5mis Chain A

Receptor sequence

>5misA (length=303) Species: 1359 (Lactococcus cremoris)

KYDVVIIGSGPAGMTAAMYTARSEMKTLLLERGVPGGQMNNTAEIENYPG
YETIMGPELSMKMAEPLEGLGVENAYGFVTGIEDHGDYKKIITEDDEFIT
KSIIIATGANHRKLEIPGEEEYGARGVSYCAVCDGAFFRNQEILVIGGGD
SAVEEALYLTRFGQSVTIMHRRDKLRAQEIIQQRAFKEEKINFIWDSVPM
EIKGDDKKIQSVVYKNVKTGEVTEKAFGGIFIYVGLDPVAEFVSDLGITD
EAGWIITDDHMRTNIPGIFAVGDVRQKDFRQITTAVGDGAQAAQEAYKFV
VEL

3D structure

• PDB: 5mis The structure of Lactococcus lactis thioredoxin reductase reveals molecular features of photo-oxidative damage.
• Chain: A
• Resolution: 1.81 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): V38 P39 M43 E48 C134 C137 D138
• Catalytic site (residue number reindexed from 1): V34 P35 M39 E44 C130 C133 D134
• Enzyme Commision number: 1.8.1.9: thioredoxin-disulfide reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	A	G14 P15 A16 E35 R36 G41 Q42 T46 N51 G81 V83 A110 T111 G112 E159 V243 G276 D277 Q285 I286	G10 P11 A12 E31 R32 G37 Q38 T42 N47 G77 V79 A106 T107 G108 E155 V239 G272 D273 Q281 I282
BS02	NAP	A	I150 G151 G152 G153 D154 S155 E158 H174 R175 R176 R180 Y237 V238 G239 L240 R284 Q285	I146 G147 G148 G149 D150 S151 E154 H170 R171 R172 R176 Y233 V234 G235 L236 R280 Q281

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004791 thioredoxin-disulfide reductase (NADPH) activity
• GO:0016491 oxidoreductase activity

Biological Process

• GO:0019430 removal of superoxide radicals
• GO:0045454 cell redox homeostasis

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:5mis, PDBe:5mis, PDBj:5mis
• PDBsum: 5mis
• PubMed: 28397795
• UniProt: A2RLJ5