Structure of PDB 5mba Chain A

Receptor sequence
>5mbaA (length=146) Species: 6502 (Aplysia limacina) [Search protein sequence]
SLSAAEADLAGKSWAPVFANKNANGLDFLVALFEKFPDSANFFADFKGKS
VADIKASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGV
GSAQFENVRSMFPGFVASVAAPPAGADAAWTKLFGLIIDALKAAGA
3D structure
PDB5mba Binding mode of azide to ferric Aplysia limacina myoglobin. Crystallographic analysis at 1.9 A resolution.
ChainA
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 AZI A F43 R66 I67 F43 R66 I67
BS02 HEM A F28 F42 F43 R66 I67 R70 F91 H95 F98 V100 Q104 F105 F28 F42 F43 R66 I67 R70 F91 H95 F98 V100 Q104 F105
Gene Ontology
Molecular Function
GO:0005344 oxygen carrier activity
GO:0005506 iron ion binding
GO:0016491 oxidoreductase activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
Cellular Component
GO:0005576 extracellular region
GO:0005833 hemoglobin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mba, PDBe:5mba, PDBj:5mba
PDBsum5mba
PubMed1931125
UniProtP02210|GLB_APLLI Globin

[Back to BioLiP]