Structure of PDB 5m7p Chain A

Receptor sequence

>5m7pA (length=441) Species: 641140 (Brucella abortus str. 2308 A)

MAADILVVDDEVDIRDLVAGILSDEGHETRTAFDADSALAAINDRAPRLV
FLDIWLQGSRLDGLALLDEIKKQHPELPVVMISGHGNIETAVSAIRRGAY
DFIEKPFKADRLILVAERALETSKLKREVSDLRLVGTSLAMNQLRQTIER
VAPTNSRIMITGPSGAGKELVARAIHAQSSRANGPFVTVNAATITPERME
IELFGTEMDKVGALEEAHGGILYLDEVADMPRETQNKILRVLVDQQFERV
GGTKRVKVDVRIISSTAQNLEGMIAEGTFREDLFHRLSVVPVQVPALAAR
REDIPSLVEFFMKQIAEQAGIKPRKIGPDAMAVLQAHSWPGNLRQLRNNV
ERLMILTRGDDPDELVTADLLPAEIGDTLPRAPTESDQHIMALPLREARE
RFEKEYLIAQINRFGGNISRTAEFVGMERSALHRKLKSLGV

3D structure

• PDB: 5m7p Three-Dimensional Structure of Full-Length NtrX, an Unusual Member of the NtrC Family of Response Regulators.
• Chain: A
• Resolution: 2.36 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	D9 D10 D53	D9 D10 D53
BS02	ADP	A	L142 V143 G173 G175 K176 E177 L178 L355 R356	L134 V135 G165 G167 K168 E169 L170 L343 R344	MOAD: Kd=70uM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Feb 20 15:14:55 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5m7p', asym_id = 'A', title = 'Three-Dimensional Structure of Full-Length NtrX,...Member of the NtrC Family of Response Regulators.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5m7p', asym_id='A', title='Three-Dimensional Structure of Full-Length NtrX,...Member of the NtrC Family of Response Regulators.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0000160,0005524,0006355,0008134,0016887,0043565', uniprot = '', pdbid = '5m7p', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000160,0005524,0006355,0008134,0016887,0043565', uniprot='', pdbid='5m7p', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>