Structure of PDB 5lzg Chain A

Receptor sequence
>5lzgA (length=103) Species: 243277 (Vibrio cholerae O1 biovar El Tor str. N16961) [Search protein sequence]
TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQV
EVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAIS
MAN
3D structure
PDB5lzg Towards new cholera prophylactics and treatment: Crystal structures of bacterial enterotoxins in complex with GM1 mimics.
ChainA
Resolution1.13 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 7BN A E11 Y12 H13 E51 Q56 H57 W88 N90 K91 E11 Y12 H13 E51 Q56 H57 W88 N90 K91 PDBbind-CN: -logKd/Ki=3.10,IC50~0.8mM
BS02 7BN A G33 K34 G33 K34 PDBbind-CN: -logKd/Ki=3.10,IC50~0.8mM
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005534 galactose binding
GO:0046812 host cell surface binding
GO:0090729 toxin activity
Biological Process
GO:0035821 modulation of process of another organism
GO:0042531 positive regulation of tyrosine phosphorylation of STAT protein
Cellular Component
GO:0005576 extracellular region
GO:0016020 membrane
GO:0020002 host cell plasma membrane
GO:0042597 periplasmic space
GO:1902494 catalytic complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5lzg, PDBe:5lzg, PDBj:5lzg
PDBsum5lzg
PubMed28539625
UniProtP01556|CHTB_VIBCH Cholera enterotoxin subunit B (Gene Name=ctxB)

[Back to BioLiP]