Structure of PDB 5lvq Chain A

Receptor sequence

>5lvqA (length=108) Species: 9606 (Homo sapiens)

DPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTM
SERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSK
IKEAGLID

3D structure

• PDB: 5lvq Discovery of New Bromodomain Scaffolds by Biosensor Fragment Screening.
• Chain: A
• Resolution: 2.05 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.48: histone acetyltransferase.
  2.3.1.57: diamine N-acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	2LX	A	F748 A757 Y809	F25 A34 Y86	MOAD: Kd=73uM PDBbind-CN: -logKd/Ki=4.14,Kd=73uM BindingDB: Kd=73000nM

Gene Ontology

Molecular Function

• GO:0004402 histone acetyltransferase activity

External links

• PDB: RCSB:5lvq, PDBe:5lvq, PDBj:5lvq
• PDBsum: 5lvq
• PubMed: 27994766
• UniProt: Q92831|KAT2B_HUMAN Histone acetyltransferase KAT2B (Gene Name=KAT2B)