Structure of PDB 5lu3 Chain A |
>5lu3A (length=88) Species: 869211 (Spirochaeta thermophila DSM 6578) [Search protein sequence] |
GEYLEMDLPFSYDGAGEYLWKTDDFSTTVDWGRYVNSWNLDLLEINGNDY TNRWVAQHQVPPASDGYWYIHYKGSLAWSHVEMKLEHH |
|
PDB | 5lu3 Stability and Ligand Promiscuity of Type A Carbohydrate-binding Modules Are Illustrated by the Structure of Spirochaeta thermophila StCBM64C. |
Chain | A |
Resolution | 1.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
2NV |
A |
W54 E86 |
W54 E86 |
|
BS02 |
CA |
A |
D7 D24 |
D7 D24 |
|
|
|