Structure of PDB 5lt8 Chain A

Receptor sequence

>5lt8A (length=227) Species: 9606 (Homo sapiens)

GPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTERKQCECTPLSK
DERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVIL
TEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYF
MALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLV
PSGSELTFDYQAQKCFCGSANCRGYLG

3D structure

• PDB: 5lt8 Structure of the Epigenetic Oncogene MMSET and Inhibition by N-Alkyl Sinefungin Derivatives.
• Chain: A
• Resolution: 1.57 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y1579 Y1666
• Catalytic site (residue number reindexed from 1): Y123 Y210
• Enzyme Commision number: 2.1.1.-
  2.1.1.359: [histone H3]-lysine(36) N-trimethyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C1631 C1678 C1680 C1685	C175 C215 C217 C222
BS02	ZN	A	C1499 C1501 C1516 C1520	C43 C45 C60 C64
BS03	ZN	A	C1516 C1529 C1533 C1539	C60 C73 C77 C83
BS04	SFG	A	K1560 G1561 W1562 H1603 Y1604 Y1605 R1625 F1626 N1628 H1629 Y1666 Q1676 C1678 F1679 L1689	K104 G105 W106 H147 Y148 Y149 R169 F170 N172 H173 Y210 Q213 C215 F216 L226

Gene Ontology

Molecular Function

• GO:0016279 protein-lysine N-methyltransferase activity
• GO:0042054 histone methyltransferase activity
• GO:0046975 histone H3K36 methyltransferase activity

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:5lt8, PDBe:5lt8, PDBj:5lt8
• PDBsum: 5lt8
• PubMed: 27571355
• UniProt: Q9BYW2|SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 (Gene Name=SETD2)