Structure of PDB 5lt7 Chain A

Receptor sequence

>5lt7A (length=243) Species: 9606 (Homo sapiens)

GETSVPPGSALVGPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLM
QCECTPLIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVIL
TEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYF
MALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLV
PSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRA

3D structure

• PDB: 5lt7 Structure of the Epigenetic Oncogene MMSET and Inhibition by N-Alkyl Sinefungin Derivatives.
• Chain: A
• Resolution: 1.51 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y1579 Y1666
• Catalytic site (residue number reindexed from 1): Y123 Y210
• Enzyme Commision number: 2.1.1.-
  2.1.1.359: [histone H3]-lysine(36) N-trimethyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	C1499 C1501 C1516 C1520	C52 C54 C60 C64
BS02	ZN	A	C1516 C1529 C1533 C1539	C60 C73 C77 C83
BS03	ZN	A	C1631 C1678 C1680 C1685	C175 C222 C224 C229
BS04	76L	A	K1560 G1561 W1562 Y1579 H1603 Y1604 Y1605 R1625 M1627 N1628 H1629 F1664 Y1666 Q1669 C1678 F1679	K104 G105 W106 Y123 H147 Y148 Y149 R169 M171 N172 H173 F208 Y210 Q213 C222 F223

Gene Ontology

Molecular Function

• GO:0016279 protein-lysine N-methyltransferase activity
• GO:0042054 histone methyltransferase activity
• GO:0046975 histone H3K36 methyltransferase activity

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:5lt7, PDBe:5lt7, PDBj:5lt7
• PDBsum: 5lt7
• PubMed: 27571355
• UniProt: Q9BYW2|SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 (Gene Name=SETD2)