Structure of PDB 5lqv Chain A

Receptor sequence

>5lqvA (length=93) Species: 3864 (Lens culinaris)

AISCGAVTSDLSPCLTYLTGGPGPSPQCCGGVKKLLAAANTTPDRQAACN
CLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVKF

3D structure

• PDB: 5lqv Ligand Binding Properties of the Lentil Lipid Transfer Protein: Molecular Insight into the Possible Mechanism of Lipid Uptake.
• Chain: A
• Resolution: N/A

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PGM	A	T8 L15 L35 L36 L52 K53 A55 A56 I59 L62 A67 I82	T8 L15 L35 L36 L52 K53 A55 A56 I59 L62 A67 I82

Gene Ontology

Molecular Function

• GO:0008289 lipid binding

Biological Process

• GO:0006869 lipid transport

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:5lqv, PDBe:5lqv, PDBj:5lqv
• PDBsum: 5lqv
• PubMed: 28266846
• UniProt: A0AT29|NLTP2_LENCU Non-specific lipid-transfer protein 2