Structure of PDB 5lqm Chain A

Receptor sequence

>5lqmA (length=303) Species: 243274 (Thermotoga maritima MSB8)

HHHHHMVDEILKLKKEKGYIILAHNFQIPELQDIADFVGDSLQLARKAME
LSEKKILFLGVDFMAELVKILNPDKKVIVPDRSATCPMANRLTPEIIREY
REKFPDAPVVLYVNSTSECKTLADVICTSANAVEVVKKLDSSVVIFGPDR
NLGEYVAEKTGKKVITIPENGHCPVHQFNAESIDAVRKKYPDAKVIVHPE
CPKPVRDKADYVGSTGQMEKIPERDPSRIFVIGTEIGMIHKLKKKFPDRE
FVPLEMAVCVNMKKNTLENTLHALQTESFEVILPKEVIEKAKKPILRMFE
LMG

3D structure

• PDB: 5lqm Crystal Structures of Quinolinate Synthase in Complex with a Substrate Analogue, the Condensation Intermediate, and Substrate-Derived Product.
• Chain: A
• Resolution: 1.62 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.72: quinolinate synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	A	C81 N109 C168 V170 E195 C254	C86 N114 C173 V175 E200 C259
BS02	FLC	A	H19 F21 D35 S36 Y107 N109 T123 S124 H193 E195 S209 T210	H24 F26 D40 S41 Y112 N114 T128 S129 H198 E200 S214 T215

Gene Ontology

Molecular Function

• GO:0008987 quinolinate synthetase A activity
• GO:0016740 transferase activity
• GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009435 NAD biosynthetic process
• GO:0019363 pyridine nucleotide biosynthetic process
• GO:0019805 quinolinate biosynthetic process
• GO:0034628 'de novo' NAD biosynthetic process from aspartate

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:5lqm, PDBe:5lqm, PDBj:5lqm
• PDBsum: 5lqm
• PubMed: 27545412
• UniProt: Q9X1X7|NADA_THEMA Quinolinate synthase (Gene Name=nadA)