Structure of PDB 5los Chain A |
>5losA (length=89) Species: 1109443 (Serendipita indica DSM 11827) [Search protein sequence] |
AQHYAQAIHHEGLARHHTTVAEDHRQTANLHDNRIKAAKARYNAGLDPNG LTSAQKHQIERDHHLSLAAQAERHAATHNREAAYHRLHS |
|
PDB | 5los A secreted fungal histidine- and alanine-rich protein regulates metal ion homeostasis and oxidative stress. |
Chain | A |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H31 H92 |
H17 H78 |
|
|
|
|