Structure of PDB 5ljc Chain A

Receptor sequence

>5ljcA (length=134) Species: 9606 (Homo sapiens)

PVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMI
IRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGE
KEGRGWTLWIEGDELHLEMRVEGVVCKQVFKKVQ

3D structure

• PDB: 5ljc Structural and molecular determinants affecting the interaction of retinol with human CRBP1.
• Chain: A
• Resolution: 1.433 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	RTL	A	L20 K40 F57 M62 I77 W106 M119	L20 K40 F57 M62 I77 W106 M119	MOAD: Kd=65nM

Gene Ontology

Molecular Function

• GO:0005501 retinoid binding
• GO:0005504 fatty acid binding
• GO:0005515 protein binding
• GO:0008289 lipid binding
• GO:0016918 retinal binding
• GO:0019841 retinol binding
• GO:1904768 all-trans-retinol binding

Biological Process

• GO:0002138 retinoic acid biosynthetic process
• GO:0006776 vitamin A metabolic process
• GO:0015908 fatty acid transport
• GO:0055088 lipid homeostasis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005811 lipid droplet
• GO:0005829 cytosol

External links

• PDB: RCSB:5ljc, PDBe:5ljc, PDBj:5ljc
• PDBsum: 5ljc
• PubMed: 28057518
• UniProt: P09455|RET1_HUMAN Retinol-binding protein 1 (Gene Name=RBP1)