Structure of PDB 5lih Chain A

Receptor sequence

>5lihA (length=326) Species: 9606 (Homo sapiens)

SLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVWVQTEKH
VFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEH
ARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGL
RPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFD
IQNTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERLGCHPQTG
FADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQ
LTPDDDDIVRKIDQSEFEGFEYINPL

3D structure

• PDB: 5lih aPKC Inhibition by Par3 CR3 Flanking Regions Controls Substrate Access and Underpins Apical-Junctional Polarization.
• Chain: A
• Resolution: 3.25 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D378 K380 N383 D396 T416
• Catalytic site (residue number reindexed from 1): D124 K126 N129 D142 T162
• Enzyme Commision number: 2.7.11.13: protein kinase C.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	S264 M341 Q345 D382 M399 F413 C414 G415 T416 P417 E445 G449	S17 M87 Q91 D128 M145 F159 C160 G161 T162 P163 E191 G195
BS02	ADP	A	G263 Y265 A266 V268 A281 K283 I332 E333 V335 D339 D382 L385 D396 F552	G16 Y18 A19 V21 A34 K36 I78 E79 V81 D85 D128 L131 D142 F290
BS03	AF3	A	R377 Y419 V434	R123 Y165 V180
BS04	MN	A	N383 D396	N129 D142
BS05	MN	A	D396 G398	D142 G144
BS06	AF3	A	S264 K380 D396	S17 K126 D142

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004674 protein serine/threonine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation
• GO:0007163 establishment or maintenance of cell polarity

External links

• PDB: RCSB:5lih, PDBe:5lih, PDBj:5lih
• PDBsum: 5lih
• PubMed: 27554858
• UniProt: P41743|KPCI_HUMAN Protein kinase C iota type (Gene Name=PRKCI)