Structure of PDB 5li1 Chain A

Receptor sequence

>5li1A (length=334) Species: 9606 (Homo sapiens)

SFSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDED
IDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQ
RQRKLPEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLT
DYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFE
MMAGRSPFDITEDYLFQVILEKQIRIPRSLSVKAASVLKSFLNKDPKERL
GCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQ
FTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLL

3D structure

• PDB: 5li1 aPKC Inhibition by Par3 CR3 Flanking Regions Controls Substrate Access and Underpins Apical-Junctional Polarization.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D378 K380 N383 D396 T416
• Catalytic site (residue number reindexed from 1): D133 K135 N138 D151 T171
• Enzyme Commision number: 2.7.11.13: protein kinase C.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	S264 Y265 E294 D295 W298 D339 M341 M344 D378 K380 G398 M399 T412 F413 C414 G415 T416 P417 N418 Y419 E445 G449 R450 T466 E467 F556	S19 Y20 E49 D50 W53 D94 M96 M99 D133 K135 G153 M154 T167 F168 C169 G170 T171 P172 N173 Y174 E200 G204 R205 T211 E212 F301
BS02	ANP	A	G263 Y265 A266 V268 A281 K283 V335 D339 D382 L385 D396 F552	G18 Y20 A21 V23 A36 K38 V90 D94 D137 L140 D151 F297
BS03	MG	A	N383 D396	N138 D151
BS04	MG	A	D292 E294 D295	D47 E49 D50

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004674 protein serine/threonine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation
• GO:0007163 establishment or maintenance of cell polarity

External links

• PDB: RCSB:5li1, PDBe:5li1, PDBj:5li1
• PDBsum: 5li1
• PubMed: 27554858
• UniProt: P41743|KPCI_HUMAN Protein kinase C iota type (Gene Name=PRKCI)