Structure of PDB 5lft Chain A

Receptor sequence

>5lftA (length=108) Species: 4932 (Saccharomyces cerevisiae)

AEFKAGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGIFGRHSGQAEG
YSYTDANIKKNVLWDENNMSEYLTNPKKYIPGTKMAFGGLKKEKDRNDLI
TYLKKATE

3D structure

• PDB: 5lft Protein Recognition by Functionalized Sulfonatocalix[4]arenes.
• Chain: A
• Resolution: 1.249 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	A	C14 C17 H18 G29 P30 I35 S40 Y48 T49 N52 M64 Y67 L68 T78 K79 M80	C19 C22 H23 G34 P35 I40 S45 Y53 T54 N57 M69 Y72 L73 T83 K84 M85
BS02	6VB	A	L85 K86	L90 K91
BS03	6VB	A	S2 K89	S7 K94

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:1901612 cardiolipin binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0006123 mitochondrial electron transport, cytochrome c to oxygen

Cellular Component

• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space

External links

• PDB: RCSB:5lft, PDBe:5lft, PDBj:5lft
• PDBsum: 5lft
• PubMed: 29125201
• UniProt: P00044|CYC1_YEAST Cytochrome c isoform 1 (Gene Name=CYC1)