Structure of PDB 5lef Chain A

Receptor sequence
>5lefA (length=166) Species: 9606 (Homo sapiens) [Search protein sequence]
LRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDR
TVRLQLWDTAGLERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDD
VRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAG
YNVKQLFRRVAAALPG
3D structure
PDB5lef Coupling fission and exit of RAB6 vesicles at Golgi hotspots through kinesin-myosin interactions.
ChainA
Resolution2.088 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GTP A Q22 S23 V24 G25 K26 T27 S28 F38 N40 Y42 A44 T45 G71 N126 K127 D129 L130 S156 A157 K158 Q12 S13 V14 G15 K16 T17 S18 F28 N30 Y32 A34 T35 G61 N116 K117 D119 L120 S146 A147 K148
BS02 MG A T27 T45 T17 T35
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0019904 protein domain specific binding
GO:0031489 myosin V binding
Biological Process
GO:0006886 intracellular protein transport
GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0006891 intra-Golgi vesicle-mediated transport
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0018125 peptidyl-cysteine methylation
GO:0019882 antigen processing and presentation
GO:0031175 neuron projection development
GO:0034067 protein localization to Golgi apparatus
GO:0034498 early endosome to Golgi transport
GO:0042147 retrograde transport, endosome to Golgi
GO:0072385 minus-end-directed organelle transport along microtubule
GO:1903292 protein localization to Golgi membrane
Cellular Component
GO:0000139 Golgi membrane
GO:0002080 acrosomal membrane
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005802 trans-Golgi network
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0012505 endomembrane system
GO:0016020 membrane
GO:0030667 secretory granule membrane
GO:0031410 cytoplasmic vesicle
GO:0032588 trans-Golgi network membrane
GO:0070062 extracellular exosome
GO:0070381 endosome to plasma membrane transport vesicle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5lef, PDBe:5lef, PDBj:5lef
PDBsum5lef
PubMed29093437
UniProtP20340|RAB6A_HUMAN Ras-related protein Rab-6A (Gene Name=RAB6A)

[Back to BioLiP]