Structure of PDB 5ld1 Chain A

Receptor sequence

>5ld1A (length=257) Species: 277 (Meiothermus ruber)

MKKYRVQPDGRFELKRFDPDDTSAFEGGKQAALEALAVLNRRLEKLQELL
YAEGQHKVLVVLQAMDAGGKDGTIRVVFDGVNPSGVRVASFGVPTEQELA
RDYLWRVHQQVPRKGELVIFNRSHYEDVLVVRVKNLVPQQVWQKRYRHIR
EFERMLADEGTTILKFFLHISKDEQRQRLQERLDNPEKRWKFRMGDLEDR
RLWDRYQEAYEAAIRETSTEYAPWYVIPANKNWYRNWLVSHILVETLEGL
AMQYPQP

3D structure

• PDB: 5ld1 Substrate recognition and mechanism revealed by ligand-bound polyphosphate kinase 2 structures.
• Chain: A
• Resolution: 2.09 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	A	D66 K70 G92 V93 P94 R106 R122 E126 D127 V130 R193	D66 K70 G92 V93 P94 R106 R122 E126 D127 V130 R193
BS02	ATP	A	D66 A67 G68 G69 K70 D71 R122 R182 K191	D66 A67 G68 G69 K70 D71 R122 R182 K191
BS03	ATP	A	Q47 Y51 N82 G85	Q47 Y51 N82 G85

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 10:50:14 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5ld1', asym_id = 'A', title = 'Substrate recognition and mechanism revealed by ligand-bound polyphosphate kinase 2 structures.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5ld1', asym_id='A', title='Substrate recognition and mechanism revealed by ligand-bound polyphosphate kinase 2 structures.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0006797,0008976,0016776', uniprot = '', pdbid = '5ld1', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006797,0008976,0016776', uniprot='', pdbid='5ld1', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>