Structure of PDB 5lab Chain A

Receptor sequence
>5labA (length=159) Species: 9606 (Homo sapiens) [Search protein sequence]
MGPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINT
GMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWT
THSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADD
IRGIQSLYG
3D structure
PDB5lab Pseudo-Contact NMR Shifts over the Paramagnetic Metalloprotein CoMMP-12 from First Principles.
ChainA
Resolution1.34 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H218 E219 H222 H228
Catalytic site (residue number reindexed from 1) H114 E115 H118 H124
Enzyme Commision number 3.4.24.65: macrophage elastase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A H218 H222 H228 H114 H118 H124
BS02 ZN A H168 D170 H183 H196 H64 D66 H79 H92
BS03 CA A D158 G190 G192 D194 D54 G86 G88 D90
BS04 CA A D124 E199 E201 D20 E95 E97
BS05 CA A D175 G176 G178 I180 D198 E201 D71 G72 G74 I76 D94 E97
BS06 NGH A I180 A182 H218 E219 H222 H228 P238 Y240 I76 A78 H114 E115 H118 H124 P134 Y136 BindingDB: Ki=4.3nM
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0031012 extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5lab, PDBe:5lab, PDBj:5lab
PDBsum5lab
PubMed
UniProtP39900|MMP12_HUMAN Macrophage metalloelastase (Gene Name=MMP12)

[Back to BioLiP]