Structure of PDB 5l9n Chain A

Receptor sequence
>5l9nA (length=92) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MKKIDAIIKPFKLDDVREALAEVGITGMTVTEVKGFDFLPKVKIEIVVPD
DIVDTCVDTIIRTAQTGKIGDGKIFVFDVARVIRIRTGEEDD
3D structure
PDB5l9n Effects of T-loop modification on the PII-signalling protein: structure of uridylylated Escherichia coli GlnB bound to ATP.
ChainA
Resolution1.901 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP A G35 I86 G87 G89 K90 G35 I69 G70 G72 K73
BS02 MG A F11 D14 D15 F11 D14 D15
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008047 enzyme activator activity
GO:0030234 enzyme regulator activity
GO:0036094 small molecule binding
GO:0042802 identical protein binding
Biological Process
GO:0006808 regulation of nitrogen utilization
GO:0042304 regulation of fatty acid biosynthetic process
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5l9n, PDBe:5l9n, PDBj:5l9n
PDBsum5l9n
PubMed28345298
UniProtP0A9Z1|GLNB_ECOLI Nitrogen regulatory protein P-II 1 (Gene Name=glnB)

[Back to BioLiP]