Structure of PDB 5l8n Chain A |
>5l8nA (length=125) Species: 9606 (Homo sapiens) [Search protein sequence] |
FTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQ HYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTS EIVGDKLVEVSTIGGVTYERVSKRL |
|
PDB | 5l8n Identification and Investigation of Novel Binding Fragments in the Fatty Acid Binding Protein 6 (FABP6). |
Chain | A |
Resolution | 2.12 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
6RQ |
A |
E12 Y15 A32 I37 |
E10 Y13 A30 I35 |
MOAD: Kd=31uM PDBbind-CN: -logKd/Ki=4.51,Kd=31uM BindingDB: Kd=2800nM |
|
|
|