Structure of PDB 5l83 Chain A

Receptor sequence
>5l83A (length=112) Species: 4113 (Solanum tuberosum) [Search protein sequence]
GPSFKLEHPLERRQAEAARIREKYPDRIPVIVEKAERSDIPDIDKKKYLV
PADLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEEHKDE
DGFLYMTYSGEN
3D structure
PDB5l83 Structural Basis of Host Autophagy-related Protein 8 (ATG8) Binding by the Irish Potato Famine Pathogen Effector Protein PexRD54.
ChainA
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A E18 I22 R29 K47 K49 Y50 L51 P53 F105 E16 I20 R27 K45 K47 Y48 L49 P51 F103
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008429 phosphatidylethanolamine binding
Biological Process
GO:0000045 autophagosome assembly
GO:0000422 autophagy of mitochondrion
GO:0006914 autophagy
GO:0006995 cellular response to nitrogen starvation
GO:0050832 defense response to fungus
GO:0097352 autophagosome maturation
Cellular Component
GO:0000421 autophagosome membrane
GO:0005737 cytoplasm
GO:0005773 vacuole
GO:0005776 autophagosome
GO:0005856 cytoskeleton
GO:0009705 plant-type vacuole membrane
GO:0016020 membrane
GO:0031410 cytoplasmic vesicle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5l83, PDBe:5l83, PDBj:5l83
PDBsum5l83
PubMed27458016
UniProtM1C146|ATG8C_SOLTU Autophagy-related protein 8C-like (Gene Name=ATG8CL)

[Back to BioLiP]